PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B03985.1.p
Common NameEUGRSUZ_B03985, LOC104434101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 344aa    MW: 38438.5 Da    PI: 8.1693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B03985.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.2e-182471148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd+ l ++v+ +G g+W++ ar  g++Rt+k+c++rw++yl
  Eucgr.B03985.1.p 24 RGPWTVEEDLSLMNYVASHGEGRWNSLARSAGLRRTGKSCRLRWLNYL 71
                      89********************************************97 PP

2Myb_DNA-binding51.13.2e-1677120146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Eucgr.B03985.1.p  77 RGNITLEEQLLILDLHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 120
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.9361975IPR017930Myb domain
SuperFamilySSF466894.49E-3120118IPR009057Homeodomain-like
SMARTSM007179.6E-142373IPR001005SANT/Myb domain
PfamPF002492.8E-162471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-222578IPR009057Homeodomain-like
CDDcd001671.48E-102671No hitNo description
SMARTSM007174.7E-1476124IPR001005SANT/Myb domain
PROSITE profilePS5129418.03276126IPR017930Myb domain
PfamPF002491.3E-1477120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2279125IPR009057Homeodomain-like
CDDcd001675.75E-1181120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MDVRGRSRCS SNIQSEEDVM GLKRGPWTVE EDLSLMNYVA SHGEGRWNSL ARSAGLRRTG  60
KSCRLRWLNY LRPDVRRGNI TLEEQLLILD LHSRWGNRWS KIAQYLPGRT DNEIKNYWRT  120
RVQKHAKQLK CDVNSKQFKD AMRYLWMPRL VERIQAAAAA SASTTTTSPG GSIVATAAAA  180
AYKTKNSSSS NNTTSSCNGN NDNGPNYRPI NGNLEQLVLP DISTKNNEFT SARLMQSYYT  240
PENSSTAASS DSLGTQVSPF SDVANPYGIS VYETPNPGYV QANQAAYQES SLFSPPSECF  300
NYGSEFFQAM DQNNQLWLDS GDFSDNLWNA ENVLYLQQQL NSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-252211825120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B03985.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045365.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE12e-87MY108_ARATH; Transcription factor MYB108
TrEMBLA0A059DAN30.0A0A059DAN3_EUCGR; Uncharacterized protein
STRINGPOPTR_0008s10080.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.13e-85myb domain protein 108